SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000030482 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030482
Domain Number 1 Region: 391-614
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.09e-75
Family ATP sulfurylase catalytic domain 0.00000000702
Further Details:      
 
Domain Number 2 Region: 216-387
Classification Level Classification E-value
Superfamily PUA domain-like 9.25e-52
Family ATP sulfurylase N-terminal domain 0.000000362
Further Details:      
 
Domain Number 3 Region: 25-216
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-37
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.000000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000030482   Gene: ENSCAFG00000015654   Transcript: ENSCAFT00000035245
Sequence length 621
Comment pep:known_by_projection chromosome:CanFam3.1:26:37724415:37745157:1 gene:ENSCAFG00000015654 transcript:ENSCAFT00000035245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGEIKPKQTGSQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTIS
FALEEYLVSHAIPCYSLDGDNVRHGLNKNLGFSPGDREENIRRIAEVAKLFADAGLVCIT
SFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGID
SDYEKPETPELVLKTNLSSVSDCVQQVVELLQEQNIVPHTVMKGIHELFVPENKLDQVRA
EAEALPSLAITKLDLQWVQVLSEGWATPLRGFMREKEYLQAIHFDTLLDGMALPDGVINM
SIPIVLPVSADDKTRLEGCSEFVLTYEGRRVAILRDPEFYEHRKEERCSRVWGTMCAKHP
HIKMVMESGDWLVGGDLQVLERIRWNDGLDQYRLTPLELKQKCKEMNADAVFAFQLRNPV
HNGHALLMQDTRRRLLDRGYKQPVLLLHPLGGWTKDDDVPLEWRMKQHAAVLEEGVLDPS
STIVAIFPSPMLYAGPTEVQWHCRSRMIAGVNFYIVGRDPAGMPHPETKKDLYEPSHGGK
VLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDG
FMAPKAWKVLTDYYGSLEKRD
Download sequence
Identical sequences E2R1E3
ENSCAFP00000030482 9615.ENSCAFP00000030482 ENSCAFP00000030482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]