SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000030645 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030645
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.92e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.0016
Further Details:      
 
Domain Number 2 Region: 251-361
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-20
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 
Domain Number 3 Region: 132-231
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-18
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000030645   Gene: ENSCAFG00000018466   Transcript: ENSCAFT00000035392
Sequence length 381
Comment pep:known_by_projection chromosome:CanFam3.1:9:40815866:40845417:-1 gene:ENSCAFG00000018466 transcript:ENSCAFT00000035392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDRERNKKRLLELLQAAGTGNAHCADCGAADPDWASYKLGIFICLNCSGVHRNFPDISK
VKSVRLDFWDDSTVEFMSHNGNLRVKAKYEARVPAFYYVPQANDCLVLKEQWIRAKYERQ
EFMADGKTMSSPGNREGFLWKRGRDNAQFLRRKFVLLAREGLLKYYTKEEGKGPKAVISI
KDLNATFETEKIGNPHGLQITYRREGHIRNLFVYHESGKEIVDWFNALRAARLQYLKTAF
PELPESELVPLITRNYLKQGFMEKTGPKQREPFKKRWFALDPQERRLLYYKNPLDAFEQG
QVFLGSNEQGYGVYEDLPKGIRGNRWKAGLTIITPERRFVFTCPSEKEQREWLESFRDVL
SRPLTPLNLLPASSESGHSSR
Download sequence
Identical sequences F1PZX4
ENSCAFP00000030645 ENSCAFP00000030645 XP_853426.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]