SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000030904 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030904
Domain Number 1 Region: 155-289
Classification Level Classification E-value
Superfamily Cyclin-like 9.59e-48
Family Cyclin 0.0000514
Further Details:      
 
Domain Number 2 Region: 292-411
Classification Level Classification E-value
Superfamily Cyclin-like 2.33e-38
Family Cyclin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000030904   Gene: ENSCAFG00000007705   Transcript: ENSCAFT00000012556
Sequence length 425
Comment pep:known chromosome:CanFam3.1:2:54257083:54264620:1 gene:ENSCAFG00000007705 transcript:ENSCAFT00000012556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRVTRNTKVNVENKAKIGMAGAKRVPLASAAASKPGLRPRTALGDIGNKVSEQPQAKL
PLKKEAKTAVPGKVIAKKIPKPLEKAPEPVPVPEPELEPEPVKEEKLSPEPILVDTPSPS
PMETSGCAPAEEYLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVK
PKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVG
VTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRSLNFGLGRPLPLHFLRR
ASKIGEVDVEQHTLAKYLMELSMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHY
LSYTEESLLNVMQHLAKNIVMVNRGLTKHMTIKNKYAASKHAKISTLAQLNSALVQDLAK
AVAKV
Download sequence
Identical sequences E2R3S2
XP_850398.1.84170 ENSCAFP00000030904 ENSCAFP00000042879 ENSCAFP00000030904 ENSCAFP00000042879 9615.ENSCAFP00000011440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]