SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000031379 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000031379
Domain Number 1 Region: 11-161
Classification Level Classification E-value
Superfamily Cyclin-like 9.14e-40
Family Cyclin 0.000000076
Further Details:      
 
Domain Number 2 Region: 162-284
Classification Level Classification E-value
Superfamily Cyclin-like 2.55e-39
Family Cyclin 0.000000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000031379   Gene: ENSCAFG00000008374   Transcript: ENSCAFT00000036048
Sequence length 323
Comment pep:known_by_projection chromosome:CanFam3.1:3:21046367:21065836:1 gene:ENSCAFG00000008374 transcript:ENSCAFT00000036048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEEMILCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPM
MENPEMLRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAALKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKPKHEEEEWTDDDLVDSL
Download sequence
Identical sequences E2R5P2
ENSCAFP00000031379 XP_536300.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]