SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000031457 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000031457
Domain Number 1 Region: 70-181
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-28
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-18
Family PDZ domain 0.0092
Further Details:      
 
Domain Number 3 Region: 204-247
Classification Level Classification E-value
Superfamily PH domain-like 0.0000025
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000031457   Gene: ENSCAFG00000007481   Transcript: ENSCAFT00000036116
Sequence length 256
Comment pep:known chromosome:CanFam3.1:3:7752603:7815480:1 gene:ENSCAFG00000007481 transcript:ENSCAFT00000036116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDYPWGFRIEFSKPIVVTEVDANSAAEEAGLQMGDVVLAVNGTEVTSVEHAEAVHLARKG
PDILTLVVGSDISRCPNTPWPTCRGYLHKRTHSGFVKGWRKRWFVLKHDGCLHYYRHKKD
EGKCPPLEIIKLEGAEVGMDSSLGKPFVFNCVPQSGNRAFCLCATSNQEMKRWLEAMDKA
THPVRQTHVWEDVTLHNSSLPPLAIKNPECLGLLHQLDRSTDMWVQHYCILKDGCLYLYA
SIRSTQASVSYILIKL
Download sequence
Identical sequences F1PCK0
ENSCAFP00000031457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]