SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000031589 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000031589
Domain Number 1 Region: 115-244
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-35
Family Phosphotyrosine-binding domain (PTB) 0.0000284
Further Details:      
 
Domain Number 2 Region: 8-94
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000344
Family Phosphotyrosine-binding domain (PTB) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000031589   Gene: ENSCAFG00000000039   Transcript: ENSCAFT00000036237
Sequence length 315
Comment pep:known_by_projection chromosome:CanFam3.1:1:8453902:8816575:-1 gene:ENSCAFG00000000039 transcript:ENSCAFT00000036237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHMRTIFRRCWLVFKKASSKGPRRLEKFPDEKAAYFRNFHKVTELHNIKNITRLPRETK
KHAVAIIFHDETSKTFACESELEAEEWCKHLCMECLGTRLNDISLGEPDLLAAGVQREQN
ERFNVYLMPTPNLDIYGECTMQITHENIYLWDIHNAKVKLVMWPLSSLRRYGRDSTWFTF
ESGRMCDTGEGLFTFQTREGEMIYQKVHSATLAIAEQHERLMLEMEQKARLQTSLTEPMT
LSKSISLPRSAYWHHITRQNSVGEIYSLQGHGFGSSKMSRAQTFPSYASEQSEEAQQALS
RSSSYGFSYSSSLIQ
Download sequence
Identical sequences F1PBN8
ENSCAFP00000031589 ENSCAFP00000031589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]