SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000031853 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000031853
Domain Number 1 Region: 61-169
Classification Level Classification E-value
Superfamily SH3-domain 1.41e-24
Family SH3-domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000031853   Gene: ENSCAFG00000016481   Transcript: ENSCAFT00000036470
Sequence length 232
Comment pep:known_by_projection chromosome:CanFam3.1:9:23161916:23166655:1 gene:ENSCAFG00000016481 transcript:ENSCAFT00000036470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSVFTAPAESEGSGPEEKSPG
QQPPKPPLRKDVGPMYSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVG
FFPANFVQRVRPGENVWRCCQPFSGNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKK
RGLGPGTQLCASTQLCPPRVPSKTTRDQPRPRHPPSRRQKGWRRGQSPPVGP
Download sequence
Identical sequences F1PEW5
ENSCAFP00000031853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]