SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000031948 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000031948
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily Serpins 3.4e-143
Family Serpins 0.0000000000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000031948   Gene: ENSCAFG00000017646   Transcript: ENSCAFT00000036554
Sequence length 419
Comment pep:known_by_projection chromosome:CanFam3.1:8:63387094:63398494:-1 gene:ENSCAFG00000017646 transcript:ENSCAFT00000036554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSITWGLLLLAGLCCLVPRSLAEGLQGDAVQETDAPHHDPEHQPACHKIAPNLADFAF
SLYRQVAQESNTTNIFFSPVSIATAFAMLSLGTKGDTHTQIMQGLGFNLTERAEREVHQG
FHQLLSILNQPDNQLQLTTGSGLFINDTIKLLNKFLEDVRKLYHSEAFTINFRHTEEAKK
QINNYVEKGTQGKIVDLVKDLDEDTVFALVNYIFFKGKWEKPFEVEHTTEEDFHVDEHTT
VKVPMMSRLGMFDIQHCATLSSWVLLMEYVGNATAFFILPDEGKMQHLESKLTKEVLAKF
LEKRYARSASLRLPKLSISGTYDLKSVLSKMGITKVFSAEADLSGITEEGPLMLSKGLHK
AVLTIDEKGTEAAGATFLEAIPMSMPPSVDFNKPFLIIIVDRDTKSPLFMGKVVNPTQK
Download sequence
Identical sequences F1PCE5
ENSCAFP00000031948 NP_001073578.2.84170 XP_005623258.1.84170 ENSCAFP00000031948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]