SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000031993 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000031993
Domain Number 1 Region: 13-127
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-29
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000031993   Gene: ENSCAFG00000023696   Transcript: ENSCAFT00000036592
Sequence length 223
Comment pep:known_by_projection chromosome:CanFam3.1:26:9004917:9005767:-1 gene:ENSCAFG00000023696 transcript:ENSCAFT00000036592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLNERSLAFYATCDTPVDNSGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDRASREPVGV
IILEGCTVELVEAAEEFAFAVRFAGARARTYVLAAENQAAMEGWVKALSRASFDYLRLVV
RELEQQLAAVRAGDCAPPPRRAPALAPKENGCPCAEWSAEPPPRPGPRGCLPPQARPPAA
PAPRGRVSEPNGPLHAAFVRLHQQYGQEVRALRSRWLRSRAQP
Download sequence
Identical sequences E2RQB2
ENSCAFP00000031993 ENSCAFP00000031993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]