SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000032110 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000032110
Domain Number 1 Region: 2-250
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.71e-62
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000157
Further Details:      
 
Domain Number 2 Region: 275-438
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.88e-19
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000032110   Gene: ENSCAFG00000006082   Transcript: ENSCAFT00000036703
Sequence length 450
Comment pep:known_by_projection chromosome:CanFam3.1:22:58902359:58946218:-1 gene:ENSCAFG00000006082 transcript:ENSCAFT00000036703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMGITDVDDKIIHRASEMNVSPASLANLYEEEFKQDMAALKVLPPTVYVRVTETIPQII
SFIEGIIANGHAYSTAQGNVYFDLQSRGDKYGKLVGVVPGPLGEPVDSDKRHASDFALWK
AAKPQEVFWASPWGKGRPGWHIECSTISSLVFGSQLDIHSGGVDLAFPHHENEIAQCEAF
HQCKQWGNYFLHSGHLHVKGKEEKMSKSLKNYITIKDFLKTFSPDVFRLFCMRSSYRAAI
DYSDGTMLEAKHLLLVVAAFVEDARAYMKGQLVCGPIRDDVLWERLCHTQEAVKAALADD
FNTPAAVDAIMDLIHHGNRQLKARTKEPGGPRSPAVFGSIVSYIKQFFETVGISLADRQL
VSEDSSRATLHSVVEELVRFRLKVRQFALATEAATREAGRQQLLDRRPLLEACDTLRQDL
AAHGISIKDRSSTSTWELLDHRTQDHKPGS
Download sequence
Identical sequences F1PXG3
ENSCAFP00000032110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]