SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000032446 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000032446
Domain Number 1 Region: 10-136
Classification Level Classification E-value
Superfamily SH2 domain 8.21e-33
Family SH2 domain 0.0000002
Further Details:      
 
Domain Number 2 Region: 145-238
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-24
Family SH2 domain 0.0000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000032446   Gene: ENSCAFG00000002171   Transcript: ENSCAFT00000037008
Sequence length 282
Comment pep:known chromosome:CanFam3.1:1:95939954:95986549:-1 gene:ENSCAFG00000002171 transcript:ENSCAFT00000037008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSTADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKA
HHYTIEREMNGTYAIAGGRTHGSPAELCHYHSQESDGLVCLLKQPFHRPPGVQPKTGPFE
DLKESLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRVESEQI
VMIGSKTNGKFLIRDRNDNGSYALCLLHEGKVLHYRIDKDKTGKLSIPDGKKFDTLWQVG
ATLTKEKAHRGGGGPRQGPSQAELLSTRRCLEASGQGTGVSG
Download sequence
Identical sequences F1PMP8
ENSCAFP00000032446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]