SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000032497 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000032497
Domain Number 1 Region: 101-296,462-676,714-744
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.9e-125
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000568
Further Details:      
 
Domain Number 2 Region: 313-462
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 2.88e-47
Family ValRS/IleRS/LeuRS editing domain 0.0000286
Further Details:      
 
Domain Number 3 Region: 747-999
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.44e-45
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000032497   Gene: ENSCAFG00000000454   Transcript: ENSCAFT00000037049
Sequence length 1062
Comment pep:known_by_projection chromosome:CanFam3.1:12:682048:695861:1 gene:ENSCAFG00000000454 transcript:ENSCAFT00000037049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSPLASLPSRCWGLGPSQALRRSHPLSTQSEPCRSSLSRRNHEAKQKRQREKQMALEA
GITPKGKAPAGSSKAWTPKEVVLYEVPTEPGEKKDVYRLLPPAYSPRYVEAAWYSWWVRE
GFFKPEYQTRLPQATGETFSMCIPPPNVTGSLHIGHALTVAIQDALVRWHRMRGDQVLWI
PGSDHAGIATQAVVEKQLWKERGMRRHELSREKFLREVWKWKDEKGGEISEQLQALGASL
DWDRECFTMDAGFSVAVTEAFVRLYEAGLLYRSQQLVNWSCTLRSAISDIEVESRPLPGH
TELQLPGCPTPVSFGLLVSVAFPVDGEPDAEVVVGTTRPETLPGDVAVAVHPDDSRYTHL
HGRQLRHPLTGQLLPLITDSTVQPHVGTGAVKVTPAHSPADAELGARHGLSPLSVIAEDG
TMTSLCGDWLQGLHRFVAREKIISALRERGLFRGLQNHPMVLPICSRSGDVIEYLLKSQW
FVRCREMGDRAAQAVESGALELSPSFHQKNWQHWFSHIGDWCVSRQLWWGHRIPAYLVVE
EHMKGDGEDCWVVGRTETEARKIAAELTGRSEAELTLQRDPDVLDTWFSSALFPFAALGW
PQETPDLARFYPLSLLETGSDLLLFWVGRMVMLGTQLTGQLPFTKVLLHSMVRDGQGRKM
SKSLGNVLDPRDIISGVELQVLQEKLKDGNLDSTELAIAAAAQRKDFPHGIPECGTDALR
FALCSHRALGGDVHLSVSEVLSSRHFCNKIWNALRFILNALGEGFVPQPAEELSPSSPTD
AWILSRLAHTAQECERAFLARELPLITHALHHFWLHSLCDVYLEAVKPVLSHSPHPQGPP
QVLFSCADVGLRLLAPLMPFLAEELWQRLPPRPGSNSAPSISVAPYPTTHSLEHWRQPAL
EQHFSQVQEAVQVLRALRATYQLTKARPRVLLQSSEPGELSLFKPFLEPLATLGHCGAVG
LLPPGVAAPSGWAQAPLSDTIQVYMELQGLVDPQAHLALLAARRRKLQKQLDGLMAWTPS
GGEEETKRQQRLSSLQLELSKLDKAASHLRQLTDACPSPKEL
Download sequence
Identical sequences F1PUF9
ENSCAFP00000032497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]