SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000032579 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000032579
Domain Number 1 Region: 1-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.44e-79
Family IMD domain 0.00000000147
Further Details:      
 
Domain Number 2 Region: 356-418
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000129
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000032579   Gene: ENSCAFG00000005700   Transcript: ENSCAFT00000037126
Sequence length 501
Comment pep:known_by_projection chromosome:CanFam3.1:9:927317:968509:-1 gene:ENSCAFG00000005700 transcript:ENSCAFT00000037126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMA
EVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAE
LKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEK
QCAVAKNSAAYHSKGKELLAQKLPLWQQACADPNKIPDRAVQLMQQMASSNGSVLPSALS
ASKSSLVISDPIPGAKPLPVPPELAPFVGRLSAQESTPVMNGVSGPDGEDYSPWADRKAA
QPKTSSPPQSQSKLSDSYSNTLPVRKSVAPKNSYAATENKTLPRSSSMAAGLERNGRMRV
KAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDGDG
GDRLHMSLQQGKSSSTGNLLDKEDLALPPPDYGTSSRAFPAQTAGTFKQRPYSVAVPAFS
QGLDDYGARAVSSAEVEVARF
Download sequence
Identical sequences F1PL36
ENSCAFP00000032579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]