SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000032749 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000032749
Domain Number 1 Region: 8-102
Classification Level Classification E-value
Superfamily SH2 domain 9.02e-23
Family SH2 domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000032749   Gene: ENSCAFG00000018602   Transcript: ENSCAFT00000037271
Sequence length 208
Comment pep:known_by_projection chromosome:CanFam3.1:20:53533799:53539082:1 gene:ENSCAFG00000018602 transcript:ENSCAFT00000037271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVPQDGEDFASQPWYHGPLSRQKAEALLQQDGDFLVRASRSRGGHPVISCRWQGSALHF
EVLRVALRPRPGRPTALFQLEDERFPSLPSLVLSYVTGQRPLSQATGAVASRPVIRQGPI
RRSFSEDTLLESPARIELPRARKRSDSQPAGLEHMGLSGEDHSGPGKGLPGQHMVQRLLC
CSLPDWYCTGGLTSWKMGSISFQNCPGD
Download sequence
Identical sequences F1PUA5
ENSCAFP00000032749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]