SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000033108 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000033108
Domain Number 1 Region: 8-96
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000207
Family Caspase recruitment domain, CARD 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000033108   Gene: ENSCAFG00000024327   Transcript: ENSCAFT00000037571
Sequence length 207
Comment pep:known_by_projection chromosome:CanFam3.1:5:82191217:82192000:-1 gene:ENSCAFG00000024327 transcript:ENSCAFT00000037571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APAMGNSQERPSETIDRERKRLVETLQADSGLLLDALLARGVLAGPEYEALDALPDAERR
VRRLLLLVQSKGEAACQELLLCAQRTARAPDPAWDWQHVGTGYRERSWDAACAGHWTPEA
PGSSTTCPELPRAADCGEPGAPGGSEAAQSGSLEEPDPELEAGAELESEPQMDLEPEPEA
EPEPELEREPEPEPEPDLEAGDESEGV
Download sequence
Identical sequences E2RC33
ENSCAFP00000033108 ENSCAFP00000033108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]