SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000033175 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000033175
Domain Number 1 Region: 44-395
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 8.32e-93
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000184
Further Details:      
 
Domain Number 2 Region: 399-562
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 5.98e-28
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000033175   Gene: ENSCAFG00000024359   Transcript: ENSCAFT00000037631
Sequence length 593
Comment pep:known_by_projection chromosome:CanFam3.1:37:7149418:7151199:1 gene:ENSCAFG00000024359 transcript:ENSCAFT00000037631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRVRALRLLGRRRASGVSVPGSCGPRHCSSGPLGVRDDAPGARAFFTTPIFYVNAAPHI
GHLYSALLADALCRHRRLRVPSAAATRFSTGTDEHGLKIQQAAAAAGLAPAELCDRVSAQ
FQQLFREAGVSSTDFVRTTEARHRVAVQHFWGLLEARGLLYKGLYEGWYCASEECFLPEA
KVTRQPGPSGDACPVSLESGHPVSWTKEENYIFRLSQFREPLRRWLRDDPQAVTPEPFRL
AVLQWLEEELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWLDALVNYLTVIGYPNAEFRAW
WPATSHIIGKDILKFHAIYWPALLLGAGMSPPHRIYVHSHWTVCGQKMSKSLGNVVDPKT
CLDRYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLDSELADALGGLLNRCTANRINPSGT
YPVFCANCFPPAPGVAGPSARAQAEDYALVNAVATLPRQVAEHYDNFQIYKALEAVSSCV
RQTNGFVQRHAPWKLSWESPVDAPWLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLG
VSATERGLGELFFLPRFYGYPCPFEGRRLGPETGLLFPRLDQSRAWLVKAHRT
Download sequence
Identical sequences E2RA59
XP_013966508.1.84170 ENSCAFP00000033175 9615.ENSCAFP00000033175 ENSCAFP00000033175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]