SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000033255 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000033255
Domain Number 1 Region: 137-337
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.58e-46
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.035
Further Details:      
 
Domain Number 2 Region: 23-111
Classification Level Classification E-value
Superfamily WWE domain 3.4e-17
Family WWE domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000033255   Gene: ENSCAFG00000015400   Transcript: ENSCAFT00000037696
Sequence length 338
Comment pep:known_by_projection chromosome:CanFam3.1:27:40982662:41026642:1 gene:ENSCAFG00000015400 transcript:ENSCAFT00000037696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEANPETFQKAEEFLPKRTDREMDEMDTSDTQWGWFYLAECGKWHMFQPDTNIQCSVSS
EDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLITGKQRLIKRAPFSISAFSYICEN
EAIPMPPHWENVNTDVPYQLVPLHSQTLEYNEVASLFGKTMDRSRIKRIQRIQNLDLWEF
FCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGALFGKGTYFARD
AAYSSRFCKDDIKHGNTFQIHGISLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSK
DGSYVNLYDSCVDDTWDPKIFVVFDANQIYPEYLIDFY
Download sequence
Identical sequences E2RKI5
XP_868009.2.84170 9615.ENSCAFP00000033255 ENSCAFP00000033255 ENSCAFP00000033255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]