SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000033725 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000033725
Domain Number 1 Region: 38-79
Classification Level Classification E-value
Superfamily F-box domain 0.00000379
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000033725   Gene: ENSCAFG00000024673   Transcript: ENSCAFT00000038060
Sequence length 452
Comment pep:known_by_projection chromosome:CanFam3.1:9:23310263:23333998:1 gene:ENSCAFG00000024673 transcript:ENSCAFT00000038060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRINTGFTLIPNQKYRRSNRRSTSYFSNTLGSDSQPLSTLGNFKALPLEIFQIILRYL
SVKDISMLSMVSKTVSQHIINYISTSSGSKRLLLQDFHNLELPSKRQDSIILEYYRSLGL
LFKRCTLLLPTKERLKYIHKILAEVSCFKFNGCAAPIQCLGLPCYGMFLQTLTAGWDELE
CHRVYNFLCELTNLSRKMQTAVCSKPGSARKLELRIRLFCRNVLLDHWTHQSDSAFWLTR
ILKPWPMVNQARLLYIIFGPVSPQDGQVVWQKMIEGPTDESSLKDLADAIKLLYDTGTKE
WTADDVISLVDELSVVPREWLLENNARLLILSGNNICFTFMASKAVNGRAIELAKLIVFL
ALVCEKELYCMDWAVKMMQKVCKVFSTPVERNNFLQSVANAFACVIMEMLQSVMSGDRDE
DDRSFLNLFHLVHAQANFHKEVLYLTMNTLST
Download sequence
Identical sequences E2RNY5
ENSCAFP00000033725 XP_013971972.1.84170 ENSCAFP00000033725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]