SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000033899 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000033899
Domain Number 1 Region: 439-506
Classification Level Classification E-value
Superfamily A DNA-binding domain in eukaryotic transcription factors 7.06e-24
Family A DNA-binding domain in eukaryotic transcription factors 0.001
Further Details:      
 
Domain Number 2 Region: 491-543
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000225
Family Leucine zipper domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000033899
Domain Number - Region: 245-359
Classification Level Classification E-value
Superfamily Serpins 0.0334
Family Serpins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000033899   Gene: ENSCAFG00000013506   Transcript: ENSCAFT00000038212
Sequence length 590
Comment pep:known_by_projection chromosome:CanFam3.1:36:20987569:21022230:-1 gene:ENSCAFG00000013506 transcript:ENSCAFT00000038212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLIDILWRQDIDLGVSREVFDFSQRRKEHELEKQKKLEKERQEQLQKEQEKAFFAQLQL
DEETGEFLPVQPAPHIPSETSASANYSQVPHIPKPDALYFDDCMQLLAETFPFVDDNEVS
SAAFQSLVPDIPSQIENPVFIAPNQAQSPQTLAVQSVIADLDNMQQDIEQVWEELLSIPE
LQCLNIQNDKLVETSMVPSPETKMTEIDNNYHFYPSMPSLEKEVGNCSPPFLSAFEDSFS
SILSTEDSSQLTVNSLNSDATINTDFGDEFYSAFIAEPSSSNSMPSSASFSQSLSELLNG
PIDVSDLSLCKAFNQNHPESTEFNDSDSGISLNTSPGMASPEHSVESSVYGDTALGFSDS
EMEETDSAPGSVKQTGPKTQPGQSAGDPAQPPSPSPGPSAPAHDAQCENTPKKESPVNPG
HRKAPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVDDFNEMMSKEQFNEAQL
ALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKK
QLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDIKKN
Download sequence
Identical sequences E2RI04
ENSCAFP00000033899 XP_005640409.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]