SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000034284 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000034284
Domain Number 1 Region: 242-361
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-27
Family SH2 domain 0.00067
Further Details:      
 
Domain Number 2 Region: 119-199
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.00000292
Family ATP sulfurylase catalytic domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000034284   Gene: ENSCAFG00000013723   Transcript: ENSCAFT00000038545
Sequence length 367
Comment pep:known_by_projection chromosome:CanFam3.1:30:11590211:11609410:-1 gene:ENSCAFG00000013723 transcript:ENSCAFT00000038545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSGAPPAAPPAPPPDILAAYRLQRERDFEDPYSGGPSSSAAAPATPTAPGPTPPPRHG
SPPHRLIRVETPGPPAPPPEERISGPPAGSDRLAILEDYADPFDVQETGEGPAGASGAPE
KVPENDGYMEPYEAQKMMAEIRSSKETAAQPLPLYDTPYEPEEEGTTPEGEGTPWPRESR
LPEDDERPPEEYDQPWEWKKERISKAFAAQFEGSEKSCLSPGREEKGRLPPRLSAGNPKS
AKPLGMEPSSPLGEWTDPALPLENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKND
FSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLY
PVAIRTL
Download sequence
Identical sequences F1PSH4
ENSCAFP00000034284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]