SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000034565 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000034565
Domain Number 1 Region: 218-332
Classification Level Classification E-value
Superfamily F-box domain 3.71e-16
Family F-box domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000034565   Gene: ENSCAFG00000001007   Transcript: ENSCAFT00000038804
Sequence length 355
Comment pep:known_by_projection chromosome:CanFam3.1:13:21809735:21838637:-1 gene:ENSCAFG00000001007 transcript:ENSCAFT00000038804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLGQDWRSPGQSWVKTADGWKRFLDEKSGGFVSDLGSYCNKEVYNKENLFNSLNYDVA
AKKRKKDMLNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFN
YVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTL
VQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFQGLTFTDLPLCLQLNIMQRL
SDGRDLVSLGQVAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKL
VRCYPRKEQYGDTLQLCRHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
Download sequence
Identical sequences E2RIW8
XP_532324.2.84170 ENSCAFP00000034565 ENSCAFP00000034565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]