SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000034607 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000034607
Domain Number 1 Region: 106-182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.2e-16
Family Complement control module/SCR domain 0.00062
Further Details:      
 
Domain Number 2 Region: 173-243
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000162
Family Complement control module/SCR domain 0.00054
Further Details:      
 
Domain Number 3 Region: 234-299
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000944
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 4 Region: 45-116
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000852
Family Complement control module/SCR domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000034607   Gene: ENSCAFG00000025063   Transcript: ENSCAFT00000038838
Sequence length 395
Comment pep:known_by_projection chromosome:CanFam3.1:7:6602851:6643653:1 gene:ENSCAFG00000025063 transcript:ENSCAFT00000038838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASRAPRTRGPCCPLSPSCSPRCSQPLRGFLMLLLLHSWVVDACDRPAYISMKPNVSKM
NFDPGDTIFFTCNLGYRPIRPLLPMSSVCQPDNTWTPLKEGCTKKSCLHPGEPSNGQVVL
VDESLLFGSKIQYSCNEGFRLVGQKNLYCEISSTDSNRVVWSDDPPLCTKILCQPPGKIE
NGKYSDSHKDEFEYNEVVTYSCEKSQGTDEYSLIGDNKLICSGDGEWSSNPPECKVVRCP
LPDPENGKLVLGFSRKYYYKARIEFECLSGFYHKGTNFAICGSNSTWEPEMPMCLKVPIP
PTTSPPILSHTVSSPPSTNSPIPSVSGSPKPSDETPPSDTSGKGYIVVVIVLCVSAGLVV
IVIVVFVVYRQKKKGKSDIRAEYSAYQDKSATTAE
Download sequence
Identical sequences F1PWC7
ENSCAFP00000034607 XP_005622378.1.84170 ENSCAFP00000034607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]