SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000034668 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000034668
Domain Number 1 Region: 106-166
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000034668
Domain Number - Region: 17-89
Classification Level Classification E-value
Superfamily Tropomyosin 0.00497
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000034668   Gene: ENSCAFG00000004444   Transcript: ENSCAFT00000007161
Sequence length 188
Comment pep:known_by_projection chromosome:CanFam3.1:16:14407208:14424295:-1 gene:ENSCAFG00000004444 transcript:ENSCAFT00000007161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YPEELIARISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQL
EGKWAVLGTLLQEYGLLQRRLENMENLLKNRNFWILRLPPGSKGEVPKVPVTFDDVAMYL
SEQEWGKLDEWQKELYKHVMRGNYETLVSLDYAISKPEVLSQTEQGKEPCSWRRPGPKVP
DVPVDPSP
Download sequence
Identical sequences F1PVI5
ENSCAFP00000034668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]