SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000034920 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000034920
Domain Number 1 Region: 183-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000685
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 2 Region: 1-29
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000477
Family Classic zinc finger, C2H2 0.0011
Further Details:      
 
Domain Number 3 Region: 92-118
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000541
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000034920   Gene: ENSCAFG00000025230   Transcript: ENSCAFT00000039110
Sequence length 247
Comment pep:novel scaffold:CanFam3.1:JH373995.1:1181:13665:-1 gene:ENSCAFG00000025230 transcript:ENSCAFT00000039110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTCHHCGKQLRSLAGMKYHVMANHNSLPILKAAGDEIDEPSERERLRTVLKRLGKLRCM
RESCSSSFTSIMGYLYHVRKCGKGAAELEEMTLKCHHCGKPYKSKAGLAYHLRSEHGPIS
FFPESGQSECLKEMSLEPKSGGRVQRHSVKIAVYHLQELASAELAKEWPKRKVLQDLVPD
DRKLKYTRPGLPTFSQEVLHKWKSDIKKYHRIQCPNQGCEAVYSSVSGLKAHLGSCTLVC
NFLNYLS
Download sequence
Identical sequences H9GWS9
ENSCAFP00000034920 ENSCAFP00000034920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]