SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000035023 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000035023
Domain Number 1 Region: 6-105
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.96e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000035023   Gene: ENSCAFG00000012815   Transcript: ENSCAFT00000039203
Sequence length 417
Comment pep:known_by_projection chromosome:CanFam3.1:24:46983899:46996034:1 gene:ENSCAFG00000012815 transcript:ENSCAFT00000039203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR
SVTMDKWKDVELEKMKAGGNAKFREFLESQEDYDPCWSLQDKYNSKAAALFRDKVATLAE
GREWCLESSPAQNWTPPQPKTLLSAAHRASGHPQNSTSSSDKAFEDWLNDDLGSYQGAQE
NRYVGFGNTVPPPKREEDFLSSAVSSLCSGWSSFTTGASKFASAAKEGATKFGSQASQKA
SELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKVQGVGSRGWRDVTTFFSGRAED
TLDRPLEGQSYQNSGGDHPQNRTVDQSFWESFGSTDPAKGHRSPSSDSWTCADASAEKRS
SDSWDVWGSGSASNNKNSDHSDLGEAWGGGGEGRAKTAKKAAPPAVPVDEGWDNQDW
Download sequence
Identical sequences E2RHR0
ENSCAFP00000035023 ENSCAFP00000035023 XP_005635339.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]