SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000035402 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000035402
Domain Number 1 Region: 152-373
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-52
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 376-508
Classification Level Classification E-value
Superfamily PH domain-like 1.82e-23
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000035402
Domain Number - Region: 503-571
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0863
Family Outer membrane efflux proteins (OEP) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000035402   Gene: ENSCAFG00000015203   Transcript: ENSCAFT00000039538
Sequence length 800
Comment pep:known_by_projection chromosome:CanFam3.1:27:38655101:38670796:-1 gene:ENSCAFG00000015203 transcript:ENSCAFT00000039538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTFAPSDESPFRGLVASRIETYGGRHQASNQSFPGGPYFRGGPGLDPSGRRLQGYVPFA
KGSGHVRSVSPLKLREPEPEKKHGGHFGAGPPHSPKVKEVTNAHQLEMRLHTFSMFGMPR
LPPEDRRYWEIGEGSDNGLVIEKSWKELVPGHKEMSRELCHQQEAIWELLTTELTYVRKL
KIMTDLLVSGLLNLQRVELLTEVSAETLFGNIPSLIRVHKSFWEEVLGPTLEETRTSGRP
LDPVSLQNGFLTFSQRFQPYVQYCLQVKRTMAYAREQQDNNPLFHAFVQWCEKHKRSGRQ
MLGDLLIKPHQRITKYPLLLQAVLKRSPEAHAREALNTMIAAVESFLRHINQQVRQGEEQ
ESLVAAAQRIGPYEVLEPSSEEVEKNLRPFCTLDLMSPMLGVASEHIRQLLLEGPVRVKE
GREGKLDVYLFLFSDVLLVTKPQRKADRAKVIRPPLMLEKLVCQPLRDPNSFLVIHLTDF
QCVSSAFIVHCPSATDCAQWLKKTQQAQATLQKLKAEEYVQQKRELLALYRDQDQDQDQE
SSGTRPSSPSPPSPPSPEGSQSSAEGRTPEFSTIIPQLVVTEDTDEDSPSVPDDTSDSGY
GTLISGSPKGPHYVSRLRPQALRRDPRLTFSTLDLRDVPLRPRPANPQAPQRRSAPELPR
QVIRRGSSLPRGDTPTWSEEEDGTSVGGNVVVETLHRAQLWGQHPPSPTHTDSAGESPWE
SSGDEEEVSHFVGPDCTPSPRPLRAEDMLREIREELASQRIEGLQEPGNSRPRKLTRGQL
QRMRGPYIIQLDTPLSTSEV
Download sequence
Identical sequences E2R8T3
ENSCAFP00000022410 ENSCAFP00000035402 9615.ENSCAFP00000035402 XP_534913.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]