SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000035591 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000035591
Domain Number 1 Region: 57-193
Classification Level Classification E-value
Superfamily PH domain-like 0.0000132
Family Phosphotyrosine-binding domain (PTB) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000035591   Gene: ENSCAFG00000003372   Transcript: ENSCAFT00000039706
Sequence length 200
Comment pep:known_by_projection chromosome:CanFam3.1:17:6524784:6532410:-1 gene:ENSCAFG00000003372 transcript:ENSCAFT00000039706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSETC
AEFRIKYVGAIEKLKFSEGKSLEGPLDLINYIDVAQQDGKLPFVPLEEEFIMGVSKYGIK
VSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQA
QAICKVLSTAFDSVLTSEKP
Download sequence
Identical sequences E2R0Z2
9615.ENSCAFP00000035591 ENSCAFP00000035591 XP_003639650.1.84170 XP_005630162.1.84170 ENSCAFP00000035591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]