SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000035976 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000035976
Domain Number 1 Region: 403-639
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-56
Family DBL homology domain (DH-domain) 0.0000374
Further Details:      
 
Domain Number 2 Region: 639-759
Classification Level Classification E-value
Superfamily PH domain-like 3.92e-31
Family Pleckstrin-homology domain (PH domain) 0.00059
Further Details:      
 
Domain Number 3 Region: 217-278
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000015
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000035976   Gene: ENSCAFG00000016889   Transcript: ENSCAFT00000043708
Sequence length 1173
Comment pep:known chromosome:CanFam3.1:7:41812353:41851088:1 gene:ENSCAFG00000016889 transcript:ENSCAFT00000043708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGDIPEVFLAGGDLVPQGHTRRCLSVVESGEQLEEEEEEGNTEKGNGFHPMPLRRSGAF
RAHNHNPFKRHSWGPGRELRDPLSRSELQASGCMGCQEAPSSQSQEELDAFLGLQRQGGQ
PSYGGQSCCHPSADPLDHSATGMLSKSVSMSGINCLLGSSDPAGNLYQSSATDLSQSCGQ
LEGGLGTWVSSPLQRTFSFFLSMTGKAKNREKEKMKEAKDARYTNGHLFTTISVSGMTMC
YACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNSTALQSVSLRSK
TTPRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFSDESPLGLRRILSQ
STDSLNMRNRALSVESLIDEGAEVIYSELMSDFETDERDFAADSWSLAVDSSFLQQQKKE
VMKQQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELQLEPGVVQGLFPCVDELSDIHTR
FLSQLLERRRQALCPGSTRNFVIHRLADLLISQFSGPSAERMRKAYSEFCSRHTKALKLY
KELYARDKRFQQFIRKVTRSAVLKRHGVQECILLVTQRITKYPVLINRILQHSHGTDEER
QDLTTALGLVKELLSNVDQDVHELEKGARLQEIYHRMDPRAQAPVPSKGPFGREELLRRK
LIHDGCLLWKTATGRFKDVLMLLMTDVLVFLQEKDQKYIFPALDKPSVVSLQNLIVRDIA
NQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQSVRVCPSREDFPLIETEDEAYLRR
IKMELQQKDKALVELLREKVGLFAEMTHFQVEEDSGGVALPALPRGLFRSESLECPRGER
LLQDAIREVEGLKDLLVGPGVELLLTPRDPALLVDPDSGGSTSPGVTANGEARNFNGSIE
LCRTDSDSSQKDRNGNQLRAPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPER
REKLARANSRDGEAGRVGPAPVAPDKQATELALLQRQHALLQEELRRCRRLGEERATEAG
NLEARLRESEQARALLEREAEEARRQLAILGQSEPPPAEAPWARRPLDPRRRSLPAGDAL
YLSFTPPQPSRGHDRLDLSVTIRSVHRPFEDRERQELGSPEERLQDSSDPDTGSEEEGGG
RLSPPHSPRDFTRMQDIPEETESRDGEPMVSES
Download sequence
Identical sequences J9JHP5
ENSCAFP00000024850 ENSCAFP00000035976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]