SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036036 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036036
Domain Number 1 Region: 464-568
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.97e-24
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.025
Further Details:      
 
Domain Number 2 Region: 329-409
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000222
Family WWE domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000036036
Domain Number - Region: 238-262
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00816
Family CCCH zinc finger 0.006
Further Details:      
 
Domain Number - Region: 266-320
Classification Level Classification E-value
Superfamily WWE domain 0.0314
Family WWE domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036036   Gene: ENSCAFG00000008875   Transcript: ENSCAFT00000045071
Sequence length 569
Comment pep:known_by_projection chromosome:CanFam3.1:23:50253666:50281139:1 gene:ENSCAFG00000008875 transcript:ENSCAFT00000045071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMETTEPEPDCVVQPPSPPDDFSCQMRLSEKISPLKTCFKKKEQKRLGTGTLRSLRPIL
NTLLESGSLDGVFRSRNQSADESSLHEPIVKKPLEISPSCPPTENSMSVLIPDGTNVGGQ
IPEAHPSTDAPEQVVPIQDHSFPPETLSGTVADSTAGHFQTDLLHPVSTDVPASPDCIDK
VMDYIPGVFQDNNFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQENGI
EICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQSVSTDSQEHLERFYCNPENDR
MRMKYGGQEFWADLNAMNVYETTEFDQLRRLSTPPSSNVNSVYHTVWKFFCRDHFGWREY
PESVIRLIEEANSRGLKEVRFMMWNNHYILHNSFFRREIKRRPLFRSCFTLLPYLQTLGG
VPTQAPPPLEATSSSQIICPDGVTSANFYPETWVYMHPSQDFIQVPVSVEDKSYRIIYNL
FHKTVPEFKYRILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQDVVD
GICKHNFDPRVCGKHATMFGQGSYFAKKV
Download sequence
Identical sequences J9JHV5
ENSCAFP00000036036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]