SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036124 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036124
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily PH domain-like 4.39e-46
Family Phosphotyrosine-binding domain (PTB) 0.000000767
Further Details:      
 
Domain Number 2 Region: 289-390
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-28
Family SH2 domain 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036124   Gene: ENSCAFG00000002201   Transcript: ENSCAFT00000048355
Sequence length 398
Comment pep:known_by_projection chromosome:CanFam3.1:1:97019997:97094805:1 gene:ENSCAFG00000002201 transcript:ENSCAFT00000048355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLDFSTRTQITREAISRVCEAVPGTKGAFRKRKPPSKMLSSILGKSNLQFAGMSISLT
ISTASLNLRTPDSKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDG
LAQDVIGSIGQAFELRFKQYLQCPSKVPAFHDRMQSLDEPWTEEEGDGSDHPYYNSIPSK
TPPPGGFVDVRLHARPHAPDTAQGRHLGDPFGEDWQQTPVRQGSLDIYSTPEARVPAAPG
EAPTYVNAQHIPVQATPASGSSTESSPLKDLFDMKPFEDALRNPVTPRAPDAKMLEELEG
EPWYQGEMSRKEAEGLLKNDGDFLVRKSATNPGSFVLTGMHNGQAKHLLLVDPEGTIRTK
DRVFDSISHLINHHLENSLPIVSAGSELCLQQPVEKTL
Download sequence
Identical sequences J9NRK0
ENSCAFP00000036124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]