SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036179 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036179
Domain Number 1 Region: 1601-2004
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.96e-101
Family Hect, E3 ligase catalytic domain 0.0000148
Further Details:      
 
Domain Number 2 Region: 458-755,845-957
Classification Level Classification E-value
Superfamily ARM repeat 1.33e-40
Family Armadillo repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 755-819
Classification Level Classification E-value
Superfamily WWE domain 0.000000131
Family WWE domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036179   Gene: ENSCAFG00000010598   Transcript: ENSCAFT00000045557
Sequence length 2011
Comment pep:known_by_projection chromosome:CanFam3.1:25:42057381:42163429:-1 gene:ENSCAFG00000010598 transcript:ENSCAFT00000045557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNRPNNNPGGSLRRSQRNTAGAQPQDDSIGGRSHLGQAKHKGYSPPESRKSNSKAPKVQ
SNTTSELSRGHLSKRSCSSSSAVIVPQPEDPDRANTSERQKTGQVPKKDNSRGVKRSASP
DYNRTNSPSSAKKPKALQHTESPSETNKPHSKSKKRHLDQEQQLKSAQSPSTSKAHTRKS
GATGGSRSQKRKRTESSCLKSGSVSESTGAEERSAKPTKLASKSAASAKAGCSTITDSSS
AASTSSSSSAVASASSTVPPGARVKQGKDQSKARRSRSASSPSPRRSSREKEQRSSKSET
SKPGPSGLQAKLASLRKSTKKRSESPPAELPSLRRSTRQKTTGSCASASRRGSGLGKRGA
AEARRQEKMADPESSQETVNSSAARTDETPQGAAASSSVAGAVGMTTSGESESDDSEMGR
LQALLEARGLPPHLFGPLGPRMSQLFHRTIGSGASSKAQQLLQGLQASDESQQLQAVIEM
CQLLVMGNEETLGGFPVKSVVPALITLLQMEHNFDIMNHACRALTYMMEALPRSSAVVVD
AIPVFLEKLQVIQCIDVAEQALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNA
LAIAANCCQSITPDEFHFVADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQ
QVASKDLLTNVQQLLVVTPPILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFL
LCGASNGSCQEQIDLVPRSPQELYELTSLICELMPCLPKEGIFAVDTMLKKGNAQNTDGA
IWQWRDDRGLWHPYNRIDSRIIEQINEDTGTARAIQRKPNPLANTNTSGYSELKKDDARA
QLMKEDPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIYFADAELLKDVLKNH
AVSSHIASMLSSQDLKIVVGALQMAEILMQKLPDIFSVYFRREGVMHQVKHLAESESLLT
SPPKACTNGSGSLGSTTSVSSGTATAATNAAADLGSPSLQHSRDDSLDLSPQGRLSDVLK
RKRLPKRGPRRPKYSPPRDDDKVDNQAKSPTTTQSPKSSFLASLNPKTWGRLSAQSNSNN
IEPARTAGVSGLARAASKDTISNNREKIKGWIKEQAHKFVERYFSSENMDGSNPALNVLQ
RLCAATEQLNLQVDGGAECLVEIRSIVSESDVSSFEIQHSGFVKQLLLYLTSKSEKDAVS
REIRLKRFLHVFFSSPLPGEEPIGRVEPVGNAPLLALVHKMNNCLSQMEQFPVKVHDFPS
GNGTGGSFSLNRGSQALKFFNTHQLKCQLQRHPDCANVKQWKGGPVKIDPLALVQAIERY
LVVRGYGRVREDDEDSDDDGSDEEIDESLAAQFLNSGNVRHRLQFYIGEHLLPYNMTVYQ
AVRQFSIQAEDERESTDDESNPLGRAGIWTKTHTIWYKPVREDEESNKDCVGGKRGRAQT
APTKTSPRNAKKHDELWHDGVCPSVSNPLEVYLISSPPENITFEDPSLDVILLLRVLHAI
SRYWYYLYDNAMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFF
FPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQ
AESVMQDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLSNPK
GSQEGTKYIQNLQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLP
FYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLT
MNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSF
RDGFESVFPLSHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDSRAVKFLFE
ILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVN
YLKLPDYSSIDIMREKLLIAAREGQQSFHLS
Download sequence
Identical sequences J9NRQ4
ENSCAFP00000036179 ENSCAFP00000015639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]