SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036233 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036233
Domain Number 1 Region: 893-1088
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.000033
Further Details:      
 
Domain Number 2 Region: 681-814
Classification Level Classification E-value
Superfamily PH domain-like 3.64e-25
Family Pleckstrin-homology domain (PH domain) 0.0000338
Further Details:      
 
Domain Number 3 Region: 5-42,76-147
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-20
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036233   Gene: ENSCAFG00000016627   Transcript: ENSCAFT00000045929
Sequence length 1143
Comment pep:known_by_projection chromosome:CanFam3.1:9:23687528:23727247:-1 gene:ENSCAFG00000016627 transcript:ENSCAFT00000045929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVLPQLPLGPRDGCSPGRPLPWQGPRTLLLHKSLQDGFGFTLRHFIVYPPESAVHCSLKE
EENGGRGGGGGGGGGPSPRHHRLEPMDTIFVKNVKDDGPAHRAGLRTGDRLVKVNGESVI
GKTYSQVIALIQNSDDTLELSIMPKDEDILQLAYSQDAYLKGNEPYSGEARSIPEPPPIC
YPRKTYAPPARVSTWATMVPEPLSALPSDPRSPAAWSDPGPRVPSTTRSHLDNSSSGMSQ
PRPSPGAFPRLPPEPRMPRAFPEPGSRVPPSRLECQQALSHWLSNQVPRRAGERRCPAMP
PRARSASQDRLEEVTAHHPWPCSTSQGALSQLGQEGWHRARSDDYLSRATRSAEALGPGA
LVSPRFERCGWASQRPSAHTSACPPRDLPAPQAPPPPGLQGLDDIGYIGYRSYSPSFQRR
TGLLHALSFRDSPFGGLPTFNLAQSPASFPPEASEPPRVVRPEPGTRALEPPTEDRRDEV
VLRQKPPTGRKVQLPPARQMNLGFGEESPEPETSGRVERLGKKMAPLATTEDSLASIPFI
DEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFALGRHYSQDCSSIKAGRR
SSYLLAITTERSKSCDDGLNTFREEGRALRRLPNRVPSLRMLRSFFTDGSLDSWGTSEDA
DAPSKRHSTSDLSDATFSDIRREGWLYYKQVLTKKGKKAGGGLRQWKRVYAALRARSLSL
SKERREPGPAAAGAAAAVAGEDEAAPVCIGSCLVDISYSETKRRHVFRLTTADFCEYLFQ
AEDRDDMLGWIRAIRENSRAEGEDPGCANQALISKKLNDYRKVSHSSAPKADSSPKISRG
LGGLKSEFLKQSAARGLRTQDQPAGNKDDSAATPKTPWGINIIKKNKKAAPRAFGVRLEE
CQPAIENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNRGPGDINLQDE
RWQDLNVISSLLKSFFRKLPEPLFTDDKYNDFIEANRIEDSRERMKTLRKLIRDLPGHYY
ETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMADMVTHMPDRYKIVETL
IQHSDWFFSDDEDKGERTPVDDKEPQSVPNIEYLLPNIGRTVPPGDPGSDSTTCSSAKSK
GTW
Download sequence
Identical sequences J9NRV8
ENSCAFP00000036233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]