SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036235 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036235
Domain Number 1 Region: 381-503
Classification Level Classification E-value
Superfamily SH2 domain 1.23e-27
Family SH2 domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036235   Gene: ENSCAFG00000002397   Transcript: ENSCAFT00000046406
Sequence length 508
Comment pep:novel chromosome:CanFam3.1:11:54190231:54329299:-1 gene:ENSCAFG00000002397 transcript:ENSCAFT00000046406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWLHIRGSLGNSKTKSPPQPPRPDYREQRRRGERPSQAPQAVPQAPAGASASCGPTAA
SCFSTSSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGGGE
PGGGQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGAGDLPGGACSGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVT
IADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPY
EPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQ
SSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAE
NLLRLCKECSYLVRNSQTSKHDYSLSLKSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEV
IHYYTTRKLPIKGAEHLSLLYPVAVRTL
Download sequence
Identical sequences J9NRW0
XP_538741.5.84170 ENSCAFP00000036235 9615.ENSCAFP00000003477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]