SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036252 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036252
Domain Number 1 Region: 131-241
Classification Level Classification E-value
Superfamily PH domain-like 7.79e-34
Family Phosphotyrosine-binding domain (PTB) 0.0000577
Further Details:      
 
Domain Number 2 Region: 7-109
Classification Level Classification E-value
Superfamily PH domain-like 6.88e-17
Family Pleckstrin-homology domain (PH domain) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036252   Gene: ENSCAFG00000028599   Transcript: ENSCAFT00000043985
Sequence length 326
Comment pep:known_by_projection chromosome:CanFam3.1:2:58946404:58957221:1 gene:ENSCAFG00000028599 transcript:ENSCAFT00000043985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNFNDIVKQGYVRMKSRKLGIYRRCWLVFRKSSSKGPQRLEKYPDEKSVCLRGCPKVT
EISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSELEAEEWYKTLSVECLGSRLNDIS
LGEPDLLAPGVQCEQTDRFNVFLLPCPNLDVYGECKLQITHENIYLWDIHNPRVKLVSWP
LCSLRRYGRDATRFTFEAGRMCDAGEGLYTFQTQEGEQIYQRVHSATLAIAEQHKRVLLE
MEKNVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNIAEASSYAGEGYGAAQASSET
DLLNRFILLKPKPSQGDSSEARTPAP
Download sequence
Identical sequences J9NRX7
ENSCAFP00000036252 XP_544390.2.84170 ENSCAFP00000036252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]