SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036323 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036323
Domain Number 1 Region: 610-814
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-37
Family DBL homology domain (DH-domain) 0.00000425
Further Details:      
 
Domain Number 2 Region: 827-954
Classification Level Classification E-value
Superfamily PH domain-like 4.21e-26
Family Pleckstrin-homology domain (PH domain) 0.00032
Further Details:      
 
Domain Number 3 Region: 318-423
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000733
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 4 Region: 44-194
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000981
Family CRAL/TRIO domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036323   Gene: ENSCAFG00000011796   Transcript: ENSCAFT00000042743
Sequence length 1130
Comment pep:known_by_projection chromosome:CanFam3.1:34:16119602:16377378:-1 gene:ENSCAFG00000011796 transcript:ENSCAFT00000042743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFWLKEEMAPQELSRRLATVITHVDEIMQQEIRPSVAVDIIEQLHRQFAILSGGRGKDG
APIITFPEFVGFKHIPEEDFLNVMTYLTSIPSVEAASIGFIIVIDRRRDKWSSIKASLTR
IAVAFPGNLQLIFILRPSRFIQRTFTDIGIKYYRDEFKMKVPIIMLNSASDLHGYIDKNQ
LTEDLGGTLEYRHSQWINHRTAIENFAMTLKTTAQMLQMFGACLTTTELPTGVLSTEDLL
MSHTRQQDKLQDELKLLGKQGTTLLSCIQEPATKSSTSKLNPNELENVATIERLLLQLDE
TEKAFNQFWSEHHSKLNQCLQLQHFEHNFCEVKLALDNLLAEQAEFTDIGDSVIRVEQIL
KEHKKLEEKGQEPLEKAQLLAIIGDQLIQSHHYAMDSIRPRCVELRHLCDDFINENKKKH
DILQKSLELHRQLDKVSQWCETGIYLLASQAVDKCQSREGVDVALNDIEAFLSTAKEYQL
PSHMEFYSQFELILTIDVKAKAQEVLQKLCDVQEIFHKRQMSLMKLAARQTRPVQPVAPH
PESSPKWMSPKTSQPFTLAPLQRTSEETYTGTLEKEDDETKFEVKNEEILESSHDGENPG
QEQLESPENLSPTRRIIHDLLETEEIYIKEIKSIIDGYITPMDFIWLKHLIPDVLQNNKE
FLFGNIRELYEFHNRTFLKELEKCTENPEMLARCFLERKEDLQIYFKYHKNLPRARAIWQ
ECQDCTFFGVCQRQLDHNLPLFKYLRGPSQRLIKYQMLLKGLLDFESPEDLGIDTGDQEG
SLAKNGPKRTKDSAFSAELQQALAMMEDLIKSCELAVDLAAVTGCPDDIRKLGKLLKHGS
FNVWTIHKDRYKMKDFIRFKPRQRQIYLFERGIVFCKIRMEPSDQGLSPHYSFKKSMKLM
TLSIRQLGRGSNRKFELANRNGLEKYILQAASKEIRDCWFSEISKLLMEQQNNIKDIYED
EENGKQISPKCCSSSECISMETFEERKGAEDMEKESSALSLSGLFQLDDSYETCSSKPVL
ATGESIPGKREGGDEDMKPSGIATFLLGWECGDPLRTSYRSLGGSGSLFSQDPPKNVGVV
FVTLFPDSIFSSDFALWQSNKSKNVSRNCGLSTYNSSNSTGHSKTFPASN
Download sequence
Identical sequences J9NS48
ENSCAFP00000036323 ENSCAFP00000017368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]