SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036400 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036400
Domain Number 1 Region: 598-709
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.83e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00035
Further Details:      
 
Domain Number 2 Region: 67-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.3e-29
Family G proteins 0.0000000382
Further Details:      
 
Domain Number 3 Region: 338-403,538-581
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000193
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036400   Gene: ENSCAFG00000000273   Transcript: ENSCAFT00000045338
Sequence length 770
Comment pep:known_by_projection chromosome:CanFam3.1:10:1792666:1807610:-1 gene:ENSCAFG00000000273 transcript:ENSCAFT00000045338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAQRQLAGAAVRAEVRRHEVAKQSLCRLRKLAERVGDPELRNSIQASLDRLHEAVVNSQ
EWTLSRSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQHKKEMLVDGQTHLVL
IREEAGAPDAKFSGWADAVILVFSLEDENSFQAVSHLHGQLTSLRGEGRGGLALALVGTQ
DRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLL
AACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTP
GSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWK
KKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGL
VKDMSTVQMGEGPEATTPTPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGD
LSPLSREPPPSPMVKKQRRKKLTTPSKTEGSAGQAEAKRKMWKLKSFGSLRNIYKAEENL
EFLIVSSTGQTGHLEAASFEERDPWVQPIESQILASLQCCESSKVKLRTDSQSEAVAIQA
IRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELT
LVLTAIGNDVANRVWESDTRGRSKPTRDSSREERESWIRAKYEQLLFLAPLGAPEEPLGR
RLWAAVQAQDVAAVLLLLAHARHGPLGXXXXXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences J9NTB5
ENSCAFP00000036400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]