SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036548 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036548
Domain Number 1 Region: 399-789
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.28e-126
Family Oxysterol-binding protein 0.0000384
Further Details:      
 
Domain Number 2 Region: 27-114,145-265
Classification Level Classification E-value
Superfamily PH domain-like 2.68e-24
Family Pleckstrin-homology domain (PH domain) 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036548   Gene: ENSCAFG00000005707   Transcript: ENSCAFT00000048113
Sequence length 889
Comment pep:known_by_projection chromosome:CanFam3.1:15:19339388:19441515:-1 gene:ENSCAFG00000005707 transcript:ENSCAFT00000048113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAGLADGEPDQTSLLGDSKDVLGPSTVVANSDESQLLTPGKMSQRQGKEAYPTPTKDLY
QPSFSPASPHSQGFERGKEDISQNKDESSLSMSKSKSESKLYNGSEKDSSASSKLTKKES
LKVQKKNYREEKKRATKELLSTITDPSVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYK
TQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPS
SYLIIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSISSESTHVTLYGLLRA
NNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEVMGKSEESDTDTSER
QDDSYIEPEPIEPLKETTYTEQSHEELGEAGEASQTETVSEENKSLIWTLLKQVRPGMDL
SRVVLPTFILEPRSFLDKLSDYYYHADFLSEAALEENPYFRLRKVVKWYLSGFYKKPKGL
KKPYNPILGETFRCLWIHPRTNSKTFYIAEQVSHHPPISAFYVSNRKDGFCLSGSILAKS
KFYGNSLSAILEGEARLTFLNRGEDYVMTMPYAHCKGILYGTMTLELGGIVNITCQKTGY
SAILEFKLKPFLGSSDCVNQISGKLKLGKEVLATLEGHWDSEVFINDKKTDNSEVFWNPT
PDIKQWRLIRHTVKFEEQGDFESEKLWQRVTRAINAKDQTEATQEKYVLEEAQRQAARDR
KTKSEEWTCKLFELDPLTGEWHYKFADTRPWDPLNDMIQFEKDGVIQTKVKHRTPMVSVP
KMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPNTRRKKGIELGDIQNSIESIKQT
QEEIKRNIMALRNHLVSSAPATDYFLQQKDYFIIFLLILLQVIINFMFK
Download sequence
Identical sequences J9NTR3
ENSCAFP00000036548 XP_013975048.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]