SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036621 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036621
Domain Number 1 Region: 68-406
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-80
Family Protein kinases, catalytic subunit 0.0000028
Further Details:      
 
Domain Number 2 Region: 873-923
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000015
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0065
Further Details:      
 
Domain Number 3 Region: 938-1069
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000086
Family Pleckstrin-homology domain (PH domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036621   Gene: ENSCAFG00000014161   Transcript: ENSCAFT00000050194
Sequence length 1547
Comment pep:novel chromosome:CanFam3.1:18:52318928:52341619:1 gene:ENSCAFG00000014161 transcript:ENSCAFT00000050194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRLRALERLARGEAGGGPGLDGLLDLLLGLHHELSSAPLRRERNVAQFLSWASPFVAK
VKELRLQRDDFEILKVIGRGAFGEVAVVRQRDSGQIFAMKMLHKWEMLKRAETACFREER
DVLVKGDSRWVTALHYAFQDEEFLYLVMDYYAGGDLLTLLSRFEDRLPPELAQFYLAEMV
LAIHSLHQLGYVHRDVKPDNVLLDMNGHIRLADFGSCLRLNNSGMVDSSVAVGTPDYISP
EILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAESLVETYGKIMNHEDHLQFPSD
VPDVPATAQDLIRRLLCRQEERLGRGGLDDFRNHPFFEGVDWEQLATSTAPYIPELRGPM
DTSNFDVDDDTLNEPGTLPPPSHGAFSGHHLPFVGFTYTSSSPGPESSSEQLAALEQKLH
CLEQEKMELSRKLQEALQVSSDHWELERLRKEVQTLQGRLSETPRDGEAEMDGSSPGQNC
NLWQERDRLVQELAEAQAGLRAQSQELCRAQERQEELLQRLQEAQEREAATASQTQALSS
QLEEAQDTSRKLQAQVTTLCREVTQLQRQWERSLEKESFRVKTIHMASETNGTGLPEGGP
QEAQLRKEVAALRMQLEAAHSHGLSGKEETLCWLQEENRRLSLEQERLVEELEREQQSKQ
QLEGERRETESNWEAQIADILSWVNDEKVSRGYLQALATKMAEELESIRNVGTQTLPARP
LDHQWKARRLQKMEASARLELQSALEAEIRAKQSLQEQLTHMQEAQLQAESRLQEAQKQS
QGLQQELAALREELAARGPGDAKSSNSLIPFRSLWSSEKDSSKDPGISGEDLRPSVEPEL
RPEGRRSLRLGAVFPRVPAAPTAPAEGPPAKPGSHALRPRSFPSPTKCLLCTSLMLGLGR
QGLGCDACGYFCHSACVPQAPPCPVPPDHLRTALGVHPETGTGTAYEGFLSVPRPSGVRR
GWQRVFAALSDSRLLLFDAPDPRLSPASGALLQALDLRDPQFSATPVLASDVIHAQTRDL
PRIFRVTASQLMVPPAVCTVLLLAESEAERERWLQVLGELQRLLLDSRPRPRPVYTLKEA
YDNGLPLLPHALCAAIIDQERLALGTEEGLFVIHLHSNDIFQVGECRRVQRLAVSPMAGL
LVVLCGRGPSVRLFALAKLESAEVVGAKIPESRGCQALAAGRILQARTPVLCVAVKRQVL
CYQLGPGPGPWQRRIRELQAPAPVQSLGLLGDRLCVGAAGAFALYPLLNEAAPLPLGASL
VPEELPPSRGGLGEALGAVELSLSEFLLLFTTAGVYVDSAGRKSRVHELLWPAVPTGWGY
AAPYLTVFSENSIDVFDVRKTEWVQTVPLKKVRPLNPEGSLFLFGTEKVRLTYLRNRLAE
KDEFDIPDLTDNSRRQLFRTKSKRHFSFRVSEEQRQQRRREMLKDPFVRSKLISPPTNFN
HLVHVGPTDGKPGARTQPPAPEGKGRGSRGSGPQRPHSFSEASRRPASVGSDGLAGDADA
RKRKPWTSLSSESVSCPQGSLSPADSLIQVSERPRSLPPAPESEGSP
Download sequence
Identical sequences J9NTY4
ENSCAFP00000020873 XP_540878.3.84170 ENSCAFP00000036621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]