SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036827 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036827
Domain Number 1 Region: 625-689,896-1233
Classification Level Classification E-value
Superfamily Ras GEF 6.28e-113
Family Ras GEF 0.000018
Further Details:      
 
Domain Number 2 Region: 224-447
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-43
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 36-132
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000216
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Domain Number 4 Region: 435-590
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000206
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036827   Gene: ENSCAFG00000008744   Transcript: ENSCAFT00000045891
Sequence length 1233
Comment pep:known_by_projection chromosome:CanFam3.1:3:25985315:26286819:-1 gene:ENSCAFG00000008744 transcript:ENSCAFT00000045891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALHLAFLARKEGTKREKMSKRAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERTPAPPRAGVGPPGARDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRIMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDSAPFTVVLLAPSRQEKAAWTSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLAKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIGALDLTTCSASSSPTATHSPAASPP
PHTGKVPLDLSRGLPSPEQSPGSVEEHVDNPRMDLCNKLKRSIQRAVLESVPVDRAGVEG
SPAVDSTDLSPCRSPSTPQHLRYRQPVGQTADNSHCSVSPASAFAIATAAAGHGSPPGFN
NTERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLP
QERKATANILRALSQDDQDDIHLKLEDIIQLTDCPKAECFETLSAMELAEQITLLDHIIF
RSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWV
AVADICRCLHNYNGVLEITSALNRSAIYRLKRTWAKVSKQTKALMDKLQKTVSSEGRFKN
LRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQT
CYRIDHQPKVISYVTCKYLASTKENLYEMSLSL
Download sequence
Identical sequences J9NUI8
ENSCAFP00000036827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]