SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036866 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036866
Domain Number 1 Region: 145-250
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.05e-28
Family FHA domain 0.00000836
Further Details:      
 
Domain Number 2 Region: 1134-1191,1229-1326
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-25
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000036866
Domain Number - Region: 667-732
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0701
Family PLC-like (P variant) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036866   Gene: ENSCAFG00000019785   Transcript: ENSCAFT00000048410
Sequence length 1347
Comment pep:known_by_projection chromosome:CanFam3.1:5:63428670:63516385:1 gene:ENSCAFG00000019785 transcript:ENSCAFT00000048410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIVQNKLSAMLYASRTPMPNWSRELKEEVTRLKDLLRAQGLGDIIDTSMGSLTSSPSSC
SLNSQVGLTSVTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMERE
ALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERR
QDIVLSGAHIQEEHCIFRSERNNSGDVIVTLEPCERSETYVNGKRVAQPVQLRSGNRIIM
GKNHVFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQGIDMKQEMEKRLQEME
ILYKKEKEEADLLLEQQRLDYESKLQALQKQVETRSLAAETTEEEEEEEEAPWTQHEFEL
AHWAFRKWKSHQFTSLRDLLWGNAVYLKEANAISVELKKKVQFQFVLLTDTLYSPLPPEL
LPAEMEKTHEDKPFPRTVVAVEVQDLKNGATHYWSLEKLKQRLDLMREMYDRAGEMASGA
QDDGEATVTGSDPFYDRFHWFKLVGRAFVYLSNLLYPVPLIHRVAIVSEKGEVRGFLRVA
VQAIAADEEAPDYGSGIRQSGTAKISFDNEYFNQNDFSSVAMTRSGLSLEELRIVEGQGQ
SSEVITPPEEINRMNDLDLKSGTLLDGKMVMEGFSEEVGNHLKLGSAFTFRVTVLQASGI
LPEYADIFCQFNFLHRHDEAFSTEPLKNNGRGSPLGFYHVQNIAVEVTESFVDYIKTKPI
VFEVFGHYQQHPLHLQGQELNSPPQPSRRFFPPPMPLSKPVPATKLNTMSKTSLGQSMSK
YDLLVWFEISELEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSELHWK
DVRELVVGRIRNKAEVDEAAVDAILSLNIISAKYLKSSHNSSRTFYRFEAVWDSSLHNSL
LLNRVTPYGEKIYMTLSAYLELDHCIQPAVITKDVCMVFYSRDAKISPPRSLRSLFGSGY
SKSPDSNRVTGIYELSLCKMADTGSPGMQRRRRKILDTSVAYVRGEENLAGWRPRGDSLI
LEHQWELEKLELLHEVEKTRHFLLLRDRLGDSIPKSLSDSLSPSLSSGTLSTSTSISSQI
STTTFESAITPSESSGYDSADIESLVDREKELATKCLQLLTHTFNREFSQVHGSISDCKL
SDISPIGRDPSVSSFSSATLTPSSTCPSLVEARSNSLDQKTPEANSRASSPCTEFEQFQI
VPTVETPYLARAGKNEFLNLVPDIEEIRPGSVVSKKGYLHFKEPLYSNWAKHFVVVRRPY
VFIYNSDKDPVERGIINLSTAQVEYSEDQQAMVKTPNIFAVCTKHRGVLLQALNDKDMND
WLYAFNPLLAGTIRSKLSRRCPSESKY
Download sequence
Identical sequences J9NUM7
ENSCAFP00000036866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]