SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036981 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036981
Domain Number 1 Region: 202-314
Classification Level Classification E-value
Superfamily PH domain-like 9.25e-21
Family Pleckstrin-homology domain (PH domain) 0.00000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036981   Gene: ENSCAFG00000020082   Transcript: ENSCAFT00000045981
Sequence length 595
Comment pep:known chromosome:CanFam3.1:9:55240314:55283679:-1 gene:ENSCAFG00000020082 transcript:ENSCAFT00000045981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKVQMEFDEKELRREIS
YAIKNIHGIRHRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKVQ
LQQYPRLREEMERIVTTHIREREGRTKEQVKVMLLIDIELAYMNTNHEDFIGFAKCSAQQ
RSNQMNKKKASGNQVQDEILVQVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDE
VQEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRCRNVYKDYRQLELACETQEEV
DSWKASFLRAGVYPERVGVQDKEKVQASETEENGSDSFMHSMDPQLERQVETIRNLVDSY
MAIVNKTVRDLMPKTIMHLMINNVQTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDE
MLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRYRSPTSSPTPQRRA
PAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAPPGVPR
CRERPGLGFPHLSPPEGHSALGTKLPEEWEEDPKQVQAFPGKEVTQLEASPYSCR
Download sequence
Identical sequences J9NUZ0
ENSCAFP00000036981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]