SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036991 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036991
Domain Number 1 Region: 255-603
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.1e-85
Family p120GAP domain-like 0.0000351
Further Details:      
 
Domain Number 2 Region: 559-701
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-35
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 3 Region: 118-232
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-28
Family Synaptotagmin-like (S variant) 0.008
Further Details:      
 
Domain Number 4 Region: 13-119
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.45e-21
Family PLC-like (P variant) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036991   Gene: ENSCAFG00000008986   Transcript: ENSCAFT00000045485
Sequence length 805
Comment pep:known_by_projection chromosome:CanFam3.1:26:10504236:10532198:-1 gene:ENSCAFG00000008986 transcript:ENSCAFT00000045485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMETLLGFTPWPRSGSSDPYCIVKVDDEVVARTATVWRSLSPFWGEEYTVHLPLDFHHL
AFYVLDEDTVGHDDIIGKISLSREAITADPRGIDSWINLSRVDPDAEVQGEICLDVQMLE
DTRGRCLRCHVLQARDLAPRDITGTSDPFARVFWGSQSLETSTIKKTRFPHWDEVLELRE
MPGAPAPLRVELWDWDMVGKNDFLGMVEFPPQVLQQNAPSGWFRLLPFPRAEEDSGGTLG
ALRLKVRLSEDRILPSGYYQPLTELLMASVLEPAEEDAASPLAVLEELTLGDCRQDLATK
LVKLFLGKGLAGPFLDYLTRREVMRTTDPNTLFRSNSLASKAMEQFMKLVGMPYLHEVLK
PVITRVFEEKKYMELDPCKMDLGRTRRISFKGTPSEEHVRDASLGLLTGYLGPIVDAIVG
SVGRCPPAMRLAFKQLHQCVEKRFPQAEHEDVKYLAISGFLFLRFFAPAILTPKLFDLRD
QHADPQTSRSLLLLAKAVQSIGNLGQQLGQGKELWMAPLHPFLLQSISRVRHFLDQLVDV
DGEEEAGSPARALVAPSVIVREGYLLKRKEEPAGLATRFAFKKRYFWLSGETLSYSKSPE
WQMRSSIPVSHIRAVERVDEGAFQLPHVMQVVTQAGAGAPHTTYLQCKNVNELNQWLSAL
RKASAPNPDKLAACHPGAFRSSRWTCCLRAERSAAGCSRTHSAVTLGDWSDPLDPDAEIQ
MVYRQLLLGRDQLRIKFQEDPSIDSSPEADTEKGSRAMEGACPDALAQQRAAAARLLEVL
ADLDRAHEEFQQREQQKVALGPLGH
Download sequence
Identical sequences J9NV00
ENSCAFP00000036991 XP_013963403.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]