SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037024 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037024
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.46e-51
Family BAR domain 0.0033
Further Details:      
 
Domain Number 2 Region: 309-428
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.88e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00016
Further Details:      
 
Domain Number 3 Region: 164-268
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-28
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 492-610
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.19e-25
Family Ankyrin repeat 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037024   Gene: ENSCAFG00000013421   Transcript: ENSCAFT00000049157
Sequence length 660
Comment pep:known_by_projection chromosome:CanFam3.1:33:30665163:30715867:1 gene:ENSCAFG00000013421 transcript:ENSCAFT00000049157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFDQTQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEAT
NILTATRKCFRHIALDYVLQINVLQSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPY
MKDLGAQLDRLVVDAAKEKREMEQKHSTIQQKDFSSDDSKLEYNVDAANGIVMEGYLFKR
ASNAFKTWNRRWFSIQNNQLVYQKKFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPT
KSCMLQADSEKLRQAWIKAVQTSIATAYREKGDESERRLIQKLDKKSSPSTGSLDSGNES
KDKLLKGESALQRVQCIPGNASCCDCGLADPRWASINLGITLCIECSGIHRSLGVHFSKV
RSLTLDTWEPELLKPKQLMCELGNDVINRVYEAKVEKMGVKKPQPGQSRQEKEAYIKAKY
VERKFVDKYAISSSPPEQEKRMVSKSCEEKRLSISKLGPGDPVRAPPQSSEAERQDSSVF
LDSKHLNPGLQLYRASYEKNLPKMAEALAHGADVNWANSEENKATPLIQAVLGGSLVTCE
FLLQNGANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLTIAVEAA
NADIVTLLRLARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
Download sequence
Identical sequences J9NV32
ENSCAFP00000037024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]