SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037191 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000037191
Domain Number - Region: 31-59
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0288
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037191   Gene: ENSCAFG00000010312   Transcript: ENSCAFT00000016367
Sequence length 211
Comment pep:novel chromosome:CanFam3.1:34:6959003:6961416:1 gene:ENSCAFG00000010312 transcript:ENSCAFT00000016367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRTPSVLSWRGRPRCHVGRAGGHHWSARDPPPPPSANPSPPPWSHLRSNKMKETITNQE
KLAKFQAQVRIGGKGTARRKKVVPGTATADDKKQFSLKKLGVSNISGIEEVNMFTNQGTV
IHFNNPKVQASLAANTFTVTGHAETKQLTEMLPRILNQLGADTLTSLRRLAEALPKQSVD
GKAPLATREDDDDEVPDLVENFDEASKNEAN
Download sequence
Identical sequences J9NVJ9
ENSCAFP00000037191 ENSCAFP00000037191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]