SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037277 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037277
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-25
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037277   Gene: ENSCAFG00000001480   Transcript: ENSCAFT00000044751
Sequence length 603
Comment pep:known_by_projection chromosome:CanFam3.1:10:26853999:26876170:-1 gene:ENSCAFG00000001480 transcript:ENSCAFT00000044751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERHGANTAPGFPSSEWSPVLSLRQPDLLNFKKGWMSILDEPGEWKKHWFVLTDSSLKYY
RDSTAEEADELDGEIDLRSCTDVTEYAVQRNYGFQIHTKDAVYTLSAMTSGIRRNWIEAL
RKTVRPTSAPDVTKLSDCNKENTLHGYSTQKGSLKAGEQRGCSEVISRGSPRKTDGQRQS
LDYVELSPLTQGSPQRARTPARTLDRPAKQEELERDLAQRSEERRKWFEATDSRPVDTAA
GEGPRRGLGAPLTEDQQSRLSEEIEKKWQELEKLPLRENKRVPLTALLNQSRGERRGPSG
DSHEALEKEVQSLRAQLEAWRLQGEVPQSAHRSQEDSHIPPGYISQEACERSLAEMESSH
QQVMEELQRHHERELQRLQQEKEWLLAEETAATASAIEAMKKAYQEELSRELSKTRSLQQ
GPDGLRKQHQSDVAALKRELQVLSEQYSQKCLEIGALMRQAEEREHTLRRCQQEGQELLR
HNQELHTCLSEEIDRLRGFIASQGTGDSCGRSSERSSCELEVLLRVKENELQYLKKEVQC
LRDELQMLQKDKRFTSGKYQDVYVELNHIKTRSEREIEQLKEHLRLAMAALQEKESMRNS
LAE
Download sequence
Identical sequences J9NVT5
ENSCAFP00000037277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]