SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037376 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037376
Domain Number 1 Region: 401-591
Classification Level Classification E-value
Superfamily Sec7 domain 4.58e-66
Family Sec7 domain 0.00000455
Further Details:      
 
Domain Number 2 Region: 623-747
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000154
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037376   Gene: ENSCAFG00000004358   Transcript: ENSCAFT00000043342
Sequence length 872
Comment pep:known_by_projection chromosome:CanFam3.1:20:3240980:3275808:-1 gene:ENSCAFG00000004358 transcript:ENSCAFT00000043342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLERKYGGRLVTRHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFSFE
GPEKVHSSYFEGKQVSVTDDGSQLGALVPAECGDLGEPPTLKSPAPSSDFADAITELEDA
FSRQVKSLAESIDDALNCRSLHTEEAPAPDAGRARDAEPKPALHGVDHNKLDEMTASYSD
VTLYIDEEELSPPLPLAQAGHRPPSTESELRLRTGGAVQDYWALAHKDNKGDTDTSCRST
PSLERQDQRLRVEHLPLLTIEPPSDSSVDLSDRSDRGSLKRQGAYERSLGGPQGSPKHGP
LGGPPKGLPREEPELRPRPPRPLDSHLAINGSANRQSKSESDYSDGDNDSINSTSNSNDT
INCSSESSSRDSLREQTLSKQTYHKETRNSWDSPAFSNDVIRKRHYRIGLNLFNKKPEKG
VQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSAM
ELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAIILL
NTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPREMLIGIYERIRKRELKTNEDHVSQV
QKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFN
DLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAVPGADIKVLINF
NAPNPQDRKKFTDDLRESIAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGNGTL
SRACLDDSYAGSEGLKRSALSSSLRDLSEAGKRGRRSSAGSLESNVEHMPRTGTPRPIVL
IRKFRPPSXXXXXXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences J9NW32
ENSCAFP00000037376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]