SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037546 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037546
Domain Number 1 Region: 753-980
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-59
Family DBL homology domain (DH-domain) 0.000000000976
Further Details:      
 
Domain Number 2 Region: 349-525
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-56
Family Regulator of G-protein signaling, RGS 0.0000000351
Further Details:      
 
Domain Number 3 Region: 984-1118
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-42
Family Pleckstrin-homology domain (PH domain) 0.00000036
Further Details:      
 
Domain Number 4 Region: 23-120
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-21
Family PDZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000037546
Domain Number - Region: 148-158,190-227
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00392
Family Formin homology 2 domain (FH2 domain) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037546   Gene: ENSCAFG00000016484   Transcript: ENSCAFT00000046159
Sequence length 1542
Comment pep:known_by_projection chromosome:CanFam3.1:7:41011882:41097257:1 gene:ENSCAFG00000016484 transcript:ENSCAFT00000046159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDRLSTLSLGDPAPERRSPSHLRQPSDTSETAGLVQRCVIIQKDQHGFGFTV
SGDRIVLVQSVRPGGAAMRAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLG
SSPLSVGVSGLQQDPAPAGAPRVTPVVPPPPPPPPLPPPQRITGPRPLQDPEFQKHATQI
LRNMLRQEEKELQRICEVYSRNPASPLEEQIEGARRRVTQLQLKIQQEMGGFVDIPTLYS
DTSQRASEGRLSLDSQEGDSGMDSGTERLPSLSEALMNRNSALSDPGLDSPRTSPVIMAR
VAQHHRRQGSDAPGPSTSEQGTDQSPKPLIIGPEEDYDPGYFNNESDIVFQDLEKLKARP
AHLGVFLRYIFSQADPSPLLFYLCAEVYQQTNPKDSRGLGKDIWNIFLEKNAPLRVKVPE
MLQAEIDLRLRGSEDIRAALHEAQEAAMPEIQEQIQDYRTKRTLGLGSLYGENDLLDLDG
DPLRERHVAEKQLAALGDILSKYEEDRSAPMDFALNTYMNHAGLRVRDARSSSLAEKAQA
APDKDKWLPFFPKTKKSSNSKKDKDALEDKRRNPILKYIGKPKSSSQSTFHIPLSPVEVK
PGNVRNIIQHFENNQPYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEM
KRSRKAENVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIE
SPSLGFCTDALLPHLLEDDLGQLSDLEPEPDTQNWQHTVGKDVVAGLSQREIDRQEVINE
LFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMRKLRE
EGPIIREIGDLMLARFDGPAREELQQVAAQFCSYQSIALGLIKTKQRKESRFQLFMQEAE
SHPQCRRLQLRDLIISEMQRLTKYPLLLESVLKHTEGGTSEHEKLCRARDQCREILKYVN
EAVKQTENQHRLEGYQKRLDTTSLERASNPLAAEFKSLDLTARRMVHEGPLTWRISKDKS
LDLHVLLLEDLLVLLQKQDEKLMLKCHSKTAAGTSDNKQTFSPVLKLNAVLIRSVATDKR
AFFIICTSELGPPQIYELVALTSSDKNTWMELLEEAVRNATRHPIAAPVLAHPPPPDAQE
PAHQSPIPTRVGLDSSEVFHSEPESGLLPGGPGPQQRVRGKHPGQLEDPEQESSIEEELG
ALPHPSASLDGESRGGRTRGPILLPLPGPLFMEGLADSALEDVERLRHLILCSLLPGHRS
EAQPTSEPEDDLTPTPSLVSSACHTGDPSSPGRAPHGGEGPEQEDMALCSLERLPPRARN
SGIWESPELDRNPEEEASGTEAAGSYKVVRKAEVVGSRAVTALPESQSGPEPPEVEGGAK
AAGNCFYVSMPAGPPDSTTEPSQPNSLPVWQTEPEPQAQLQGGSGGCRRPSRSPPSMALR
DVGNIFHTIEQLTVKLNRLKDMELAHRELLRSLAGESSGGTTPVGSFHTEAARWTDHSLS
PPAREPLASDSRDSHQPGPCSEDGSNTPLEDGTTHAASSPGL
Download sequence
Identical sequences J9NWK1
ENSCAFP00000037546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]