SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037592 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037592
Domain Number 1 Region: 30-179
Classification Level Classification E-value
Superfamily PH domain-like 8.73e-44
Family Phosphotyrosine-binding domain (PTB) 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037592   Gene: ENSCAFG00000029519   Transcript: ENSCAFT00000043521
Sequence length 309
Comment pep:known_by_projection chromosome:CanFam3.1:2:74337539:74364115:-1 gene:ENSCAFG00000029519 transcript:ENSCAFT00000043521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALKSAGRALIRSPSLAKQSWGGGGRHRKLPENWTDTRETLLEGMLFSLKYLGMTLVEQ
PKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILTDNITNQLIENVSIYRISYCT
ADKMHDKVFAYIAQSQHNENLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKE
KREKASQEGGDLLGGGLRDSTPSLKSLVATGNLLDLEETAKAPLSTVSANTTKVDEAPRP
QALNNSSVVWELDDGLDEAFSRLAQSRTNPQVLDIGLTAQDIHYAQCLSPVDWDKPDSSS
TEQDDLFSF
Download sequence
Identical sequences J9NSB3
XP_855049.1.84170 9615.ENSCAFP00000018825 ENSCAFP00000037592 ENSCAFP00000037592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]