SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037755 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037755
Domain Number 1 Region: 36-178
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-35
Family Pleckstrin-homology domain (PH domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037755   Gene: ENSCAFG00000009649   Transcript: ENSCAFT00000048831
Sequence length 1073
Comment pep:known_by_projection chromosome:CanFam3.1:38:795317:838810:-1 gene:ENSCAFG00000009649 transcript:ENSCAFT00000048831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNKAGGKRPAITNSDVSNLNMVSEVPSERPGVRATRTSRKAIAFGKRSHSMKRNLNAPV
TKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNI
SRKYTFKVSTCWVDEARASSTHCLSPQAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQ
IPPAQKSVPQAVHHNHEKPDSENIPPSKHHHQPSHNSVPKPEPEAKTRGEGDGRGCEKAE
RKPERPEVKSEPLVKANGIQAGPEPASEPGSPYPEGPSVPGGGDRPAQPNGWQYSSPSRP
GSTAFLPQDSESGGHQRSFPPRANPDKIAQRKSSMNQLQQWVNLRRGVPPPEDLRSPSRF
YPVSRRVPEYYGPYSSQYPDDYQYYPAGVRPDSICSMPAYDRISPPWTGEDKRLSFRNGG
GPAFQLREWKEPPGYGRQDGPVWLPGPSPFPPPRQPVYYDELDATSGSLRRLSLQPRSHS
VPRSPSQGSYGRARIYSPVRSPSARFERLPPRSEDLYADPAAYVMRRSISSPKVPPYPEV
FRDGLHTYKLNEQDTDKLLGKLCEQNKVVREQDRLVQQLRAEKESLESALMGTHQELEMF
GNQPAYPEKLLHKKESLQNQLINIRVELSQATTALTNSTIEYESLESEVSALHDDLWEQL
NLDVQNEVLNRQIQKEIWRIQDVMEGLRKNNPSRGTDTAKHRGGLGPTATYNSNSPASPL
SSASLTSPLSPFSLVSGSQGSPTKPGSSEPKASYEQSKKDPYQTSPLDTTRDISLVPTRQ
EVEAEKQAALNKVGIVPPRTKSPTDEEGTPSRVVRRSANGLTNGLSSRERPKSAVFPSEG
KVKMSVEEQMDRMRRHQSGSMKEKRRSLQLPASPAPDPASRPTYKVVRRHRSIHEVDISN
LEAALRAEEPGGQAYETPREEIARLRKMELEPQHYDVDINKELSTPDKVLIPERYIDLEP
DTPLSPEELKEKQKKVERIKTLIAKSSMQNVVPIGEGDLVDVPQDSESQLQEQEKRIEIS
CALATEASRRGRMLSVQCATPSPPTSPASLTPPANPLSSDSPRGADSSHTMRV
Download sequence
Identical sequences J9NWU4
ENSCAFP00000037755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]