SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037778 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037778
Domain Number 1 Region: 436-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.99e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 381-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.29e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 324-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 1-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 6 Region: 480-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-18
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 231-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000352
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037778   Gene: ENSCAFG00000030172   Transcript: ENSCAFT00000048056
Sequence length 539
Comment pep:novel chromosome:CanFam3.1:1:104901622:104914837:1 gene:ENSCAFG00000030172 transcript:ENSCAFT00000048056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVCQEQLTFKDVAIKFSEEEWECLDSAQRALYRDVMLENYRNLVSLDSSASFMIKELLP
KKEINNRKLCQPVVLGRQESHDLEDFDLREIWGNMYEFENKCGHEERNSRGVLVTDTVNL
TGRKDKQDSKSRTNLPLKQSVSLRKGTYQYFKQVKSLVKNSLKIKNNMVYAGSKYTKCLE
NRIGLNFQSQLPKMQRFQTEEKMNECNQVEKPVKTCSPIVPLQRFPPSIKTNLCNKYGRV
SMYPSLLTQHQKTKIREKSYKCNECGKTFSHHSVLTSHQRIHSEQRPYKCNECGKAFKQF
SNLTRHQRIHTGEKPYKCNICDKVFNQNSHLTNHWRIHTGEKPHKCHECGKAFIKCSDLS
CHERIHTGEKPYKCNECGKGFTKRSYLWDHERIHTGEKPYKCIECGKVFRQWSTLRIHRR
IHTGEKPYKCNVCGKAFSQNSNLTIHQRIHTGEKPYKCNECGKAFKQYSSLIRHQNIHPG
EKPYKCIVCGKAFIKRSHLWGHERTHPGEKPYKCIECGKSFRQCSDLRIHQRIHAGEEP
Download sequence
Identical sequences J9NWW7
XP_013970505.1.84170 ENSCAFP00000037778 ENSCAFP00000037778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]